Guanidine


Also found in: Dictionary, Medical, Wikipedia.
Related to Guanidine: guanidinium

guanidine

[′gwän·ə‚dēn]
(biochemistry)
CH5N2 Aminomethanamidine, a product of protein metabolism found in urine.

Guanidine

 

(also carbamidine). (H2N)2C=NH, colorless hygroscopic crystals; melting point, approximately 50° C. Guanidine absorbs C02 and moisture from the air and forms salts with acids. On hydrolysis it gives urea and ammonia.

Guanidine (or its salts) is obtained by reacting cyanamide with ammonia (or with ammonium salts).

H2N—C≡N + NH3→(H2N)2C═NH

H2N —C≡N +NH4Cl→(H2N)2C═NH.HCI

Guanidine is used to obtain medicinal and explosive substances and ion-exchange resins. A guanidine fragment enters into the composition of guanine (a component of nucleic acids), creatine, and arginine, the antibiotic streptomycin, and tetrodotoxin, a poison of animal origin.

References in periodicals archive ?
It was interesting to study if the reactive blending via transamination reaction using terminal amine and guanidine groups of PHMG with ester units of PBAT at high temperature in an extruder leading to covalent immobilization was possible or not.
Nitensidine A, a guanidine alkaloid from Pterogyne nitens, is a novel substrate for human ABC transporter ABCB1.
In particular, diphenyl guanidine (DPG) is largely used at the industrial scale.
DIDS and Hoe 694 (3-methylsulfonyl-4-piperidinobenzoyl, guanidine hydrochloride) were added, as solids, to solutions shortly before use.
35 g/ml of MNNG (N-methyl-N nitro-N-Nitroso guanidine, Sigma Chemicals) at 37C for 1, 2 and 3 h.
The samples then have been resuspended in 6M of guanidine hydrochloride.
Among the topics are the topological modeling of materials based on different binders incorporated with powder fillers, antioxidant activity in some isobornylphenol derivatives at the destruction of polyvinyl chloride, complex-forming properties of the new composite materials based on dialdehide cellulose and acrylate derivatives of guanidine with d-elements, comparing free-radical scavenging properties of glutathione under neutral and acidic conditions, and studying elastic polyurethane thermal stability by differential scanning calorimetry.
Michael and his coworkers have synthesized, characterized, and studied the thermal degradation of a terpolymer prepared from salicylic acid, guanidine, and formaldehyde [8] and 8-hydroxyquinoline-guanidineformaldehyde [9].
One aliquot (PBS aliquot) was diluted with 180 [micro]L of phosphate-buffered saline (PBS) and the other (G aliquot) was diluted with 180 [micro]L of 1M guanidine solution (G) (Sigma-Aldrich).
42] (>97% peptide purity; sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG- GVVIA) were purchased from rPeptide; guanidine HCl, phosphoric acid 85% Suprapur, ammonia Suprapur, NaOH, NaCl, KCl, and NaHC[O.
The main active ingredient in a no-lye relaxer is calcium hydroxide, or guanidine hydroxide.

Full browser ?