divalent


Also found in: Dictionary, Thesaurus, Medical, Wikipedia.

divalent

Chem
1. having a valency of two
2. having two valencies
Collins Discovery Encyclopedia, 1st edition © HarperCollins Publishers 2005
References in periodicals archive ?
In this study, [Ba.sup.2+] with a phenol content of 0.45 percent was added as a catalyst in the synthesis of phenolic resin, according to investigations on the effect of different divalent metal hydroxide catalysts added at different concentrations on the polymerization rate of PF resin in a previous study (Chen et al.
The Si-K fertiliser improved the displacement of [Na.sup.+] with divalent cations such as [Ca.sup.2+] and [Mg.sup.2+], thus helping to the flocculation of dispersed clay, which is similar to results reported by Chi et al.
Alginate in the presence of divalent cations such as [Ca.sup.+2], [Ba.sup.+2] form gels, and crosslinking occurs through the attachment of these cations to the negative charges of the carboxy groups of the alginate chain.
As the name implies, in enzymes activated by metals, catalysis is triggered by the presence of a mono- or divalent metal ion on the outside of the protein.
To shield these divalent metal ions, two types of chelating agents with different concentrations were chosen and compared, and they are EDTA and Gl-47S.
Indeed, the observed optical properties of ODC(II) can be reproduced almost satisfactorily by the divalent Si model rather than the unrelaxed oxygen vacancy model [18-20].
During the course of our investigation of LDHs as a scale inhibitor, we were interested in using Mg and Ca as divalent metal ions to prepare Mg-Al- and Ca-Al layered double hydroxides intercalated with P[O.sub.4.sup.3-], P[O.sub.4.sup.3-]/P[F.sub.6.sup.-], and S[O.sub.4.sup.-2- anions, and we have been successful in synthesizing four new LDHs with nanostructures, namely, Mg-Al[(OH).sub.2]P[O.sub.4] (1), Mg-Al[(OH).sub.2]P[O.sub.4]P[F.sub.6] (2), Ca-Al[(OH).sub.2]S[O.sub.4] (3), and Ca-Al [(OH).sub.2]P[O.sub.4]P[F.sub.6] (4).
The curcumin release profiles of the microparticles were observed to compare the effects of the formulation method, pectinase, and divalent cations on drug release.
The amino acid sequence of the divalent peptide vaccine is GFANQTEVKANGDGNPREVIEDLAANNPAIQNIRLDHSDLVAEKQRLEDLGQKFERLKQRSELYLQQYYDASR- EAKKQVEKALE.
Divalent cations promotes DNA adsorption and form complexes with phosphate backbone of DNA and enhance its adsorption (Paget et al., 1992).
As reported in literature, alginate's affinity toward the different divalent ions decreases as follows: [Pb.sup.2+] > [Cu.sup.2+] > [Cd.sup.2+] > [Ba.sup.2+] > [Sr.sup.2+] > [Ca.sup.2+] > [Co.sup.2+], [Ni.sup.2+], [Zn.sup.2+] > [Mn.sup.2+] [11-13].